Protein trichome birefringence-like

Author: rckn

August undefined, 2024

WebbProtein trichome birefringence-like 30 OS=Arabidopsis thaliana GN=TBL30 PE=2 SV=1: trembl. ID: B9SQN5: description: Putative uncharacterized protein OS=Ricinus communis … Webb25501484 - Gene ResultLOC25501484 protein trichome birefringence-like 2 [ (barrel medic)] Gene provides a unified query environment for genes defined by sequence …

AT3G11030(TBL32) - Arabidopsis

WebbProtein trichome birefringence-like 19 OS=Arabidopsis... 0.02: Archaeplastida: Pp3c16_10090V3.1: No alias: TRICHOME BIREFRINGENCE-LIKE 25: 0.02: Archaeplastida: Functional Annotation. GO; Predicted GO; InterPro; Type GO Term Name Evidence Source; No GO annotation available for this sequence. Toggle parental. Type GO Term WebbTitle: Genome-wide characterization of trichome birefringence-like genes provides insights into fiber yield improvement: Authors : Li, Z., Shi, Y., Xiao, X., Song, J ... times news burlington nc classified ads

GSVIVT01032519001 details

WebbSearch BioGRID for SARS-CoV-2 Protein Interactions Download SARS-CoV-2 and Coronavirus-Related Interactions Arabidopsis thaliana (Columbia) TBL25 F6F3.23, F6F3_23, TRICHOME BIREFRINGENCE-LIKE 25, AT1G01430 protein trichome birefringence-like 25 GO Process (0) GO Function (0) GO Component (0) TAIR Entrez Gene RefSeq UniprotKB Webb(RefSeq) protein trichome birefringence-like 21. Organism: csat Camelina sativa (false flax) SSDB: Ortholog Paralog Gene cluster GFIT: Motif: Pfam: PC-Esterase PMR5N … WebbGene Model Type. protein_coding. Other names: TBL19, TRICHOME BIREFRINGENCE-LIKE 19. Description. Encodes a member of the TBL (TRICHOME BIREFRINGENCE-LIKE) gene … parentheses vba

106799527 - Gene ResultLOC106799527 protein trichome …

TRICHOME BIREFRINGENCE and Its Homolog AT5G01360 Encode …

Webb12 jan. 2024 · These included 1 calmodulin-binding transcription activator, 1 cyclic nucleotide-gated ion channel, 1 protein trichome birefringence-like protein, 1 plant UBX … Webb(RefSeq) protein trichome birefringence-like 19. Organism: lang Lupinus angustifolius (narrow-leaved blue lupine) SSDB: Ortholog Paralog Gene cluster GFIT: Motif: Pfam: PC … parentheses usage grammarWebbTitle: Genome-wide characterization of trichome birefringence-like genes provides insights into fiber yield improvement: Authors : Li, Z., Shi, Y., Xiao, X., Song, J ... times news burlington nc obit

"WebbProtein trichome birefringence-like 23 OS=Arabidopsis thaliana: 0.02: Archaeplastida: Gb_25866: No alias: mannan O-acetyltransferase (MOAT) 0.03: Archaeplastida: LOC_Os01g46410.1: No alias: Protein trichome birefringence-like 21 OS=Arabidopsis... 0.03: Archaeplastida: LOC_Os06g12840.1: No alias: " - Protein trichome birefringence-like

Protein trichome birefringence-like

WebbLOC106799527 protein trichome birefringence-like 13 [ (soybean)] Gene ID: 106799527, discontinued on 21-Apr-2024 Summary DISCONTINUED: This record has been withdrawn … WebbProtein trichome birefringence-like 19 OS=Arabidopsis thaliana: 0.03: Archaeplastida: AMTR_s00088p00114920: evm_27.TU.AmTr_v1... Protein ALTERED XYLOGLUCAN 4-like …

Did you know?

Webbprotein_coding. Species: Arabidopsis thaliana. Synonyms: TRICHOME BIREFRINGENCE-LIKE 34 [Source:NCBI gene (formerly Entrezgene);Acc ... Summary: Description: … Webbannotation: yls7 locus:2153077 at5g51640 at5g51640 yls7 tbl17 yellow-leaf-specific gene 7 trichome birefringence-like 17 k17n15.19 k17n15_19

WebbLOC100832208 protein trichome birefringence-like 1 [ (stiff brome)] Gene ID: 100832208, updated on 19-Aug-2024. Summary Other designations. protein trichome birefringence … WebbWe combine protein signatures from a number of member databases into a single searchable resource, capitalising on their individual strengths to produce a powerful …

WebbProtein trichome birefringence-like 19 OS=Arabidopsis... 0.02: Archaeplastida: Pp3c16_10090V3.1: No alias: TRICHOME BIREFRINGENCE-LIKE 25: 0.02: … Webb5 juni 2024 · As functional proteins, dehydrins are found in many maturing seeds and vegetable tissues under adverse environmental conditions. However, the regulation of …

Webb28 juni 2011 · Protein Protein trichome birefringence-like 33 Gene TBL33 Status UniProtKB reviewed (Swiss-Prot) Organism Arabidopsis thaliana (Mouse-ear cress) …

WebbRepresentative Gene Model AT3G11030.1 Gene Model Type protein_coding Other names: TBL32, TRICHOME BIREFRINGENCE-LIKE 32 Description Encodes a member of the TBL … parentheses usage mathWebbTwo grain amaranth transcription factor (TF) genies were overexpressed in Arabidopsis plants. The start, coding on a grouping VII ethylene retort factor TF (i.e., AhERF-VII) conferred tolerance to water-deficit stress (WS) in transgenic Arabidopsis without affecting veg or reproduction growth. A significantly lower water-loss rate in aloof quit coupled to … times-news burlington ncWebb1 okt. 2024 · The TRICHOME BIREFRINGENCE-LIKE (TBL) family is an important gene family engaged in the O -acetylation of cell wall polysaccharides. There have been a few … parentheses usesWebbProtein trichome birefringence-like 38 OS=Arabidopsis thaliana: ... Protein trichome birefringence OS=Arabidopsis thaliana... 0.02: Archaeplastida: Solyc03g096030.3.1: No … parentheses vise blazer anthropologyWebbProtein trichome birefringence-like 20 OS=Arabidopsis... 0.02: Archaeplastida: Pp3c16_10090V3.1: No alias: TRICHOME BIREFRINGENCE-LIKE 25: 0.02: Archaeplastida: Zm00001e028495_P002: No alias: no hits & (original description: none) 0.02: Archaeplastida: Smo404468: No alias: Protein trichome birefringence-like 23 … times news breaking newsWebbProtein trichome birefringence-like 19 OS=Arabidopsis thaliana: 0.02: Archaeplastida: Solyc03g046270.4.1: No alias: Protein trichome birefringence-like 19 OS=Arabidopsis... 0.04: Archaeplastida: Zm00001e009759_P001: No alias: xyloglucan O-acetyltransferase (AXY4) 0.04: Archaeplastida: Zm00001e020949_P001: parentheses used forWebbgenome browser: aa seq: 440 aa aa seq db search mgiladlcyervishmsediwylnmklhtfeapsgnksvlwnfhkgillaltlilltiip … times-news burlington nc obituaries